Lineage for d2fgwh2 (2fgw H:125-228)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289104Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289167Domain d2fgwh2: 2fgw H:125-228 [20957]
    Other proteins in same PDB: d2fgwh1, d2fgwl1, d2fgwl2
    part of humanized Fab H52

Details for d2fgwh2

PDB Entry: 2fgw (more details), 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgwh2 b.1.1.2 (H:125-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd

SCOP Domain Coordinates for d2fgwh2:

Click to download the PDB-style file with coordinates for d2fgwh2.
(The format of our PDB-style files is described here.)

Timeline for d2fgwh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fgwh1