SCOP 1.59: Domain d2fgwh2: 2fgw H:125-228

Lineage for d2fgwh2 (2fgw H:125-228)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab H52 (synthetic, humanised version), kappa L chain [48990] (1 PDB entry)

8. Domain d2fgwh2: 2fgw H:125-228 [20957]
   Other proteins in same PDB: d2fgwh1, d2fgwl1

Details for d2fgwh2

PDB Entry: 2fgw, 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwh2:

Sequence; same for both SEQRES and ATOM records:

>d2fgwh2 b.1.1.2 (H:125-228) Immunoglobulin (constant domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd

Timeline for d2fgwh2:

• d2fgwh2 first appeared (with stable ids) in SCOP 1.55
  
• d2fgwh2 appears in SCOP 1.57
  
• d2fgwh2 appears in SCOP 1.61
  
• d2fgwh2 appears in the current release, SCOPe 2.08