![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fab H52 (synthetic, humanised version), kappa L chain [48990] (1 PDB entry) |
![]() | Domain d2fgwh2: 2fgw H:125-228 [20957] Other proteins in same PDB: d2fgwh1, d2fgwl1 |
PDB Entry: 2fgw (more details), 3 Å
SCOP Domain Sequences for d2fgwh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgwh2 b.1.1.2 (H:125-228) Immunoglobulin (constant domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
Timeline for d2fgwh2: