Lineage for d2fgwh2 (2fgw H:125-228)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747676Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2747924Domain d2fgwh2: 2fgw H:125-228 [20957]
    Other proteins in same PDB: d2fgwh1, d2fgwl1, d2fgwl2
    part of humanized Fab H52

Details for d2fgwh2

PDB Entry: 2fgw (more details), 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65
PDB Compounds: (H:) h52 fab (heavy chain)

SCOPe Domain Sequences for d2fgwh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgwh2 b.1.1.2 (H:125-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd

SCOPe Domain Coordinates for d2fgwh2:

Click to download the PDB-style file with coordinates for d2fgwh2.
(The format of our PDB-style files is described here.)

Timeline for d2fgwh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fgwh1