Lineage for d3eo0c1 (3eo0 C:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744392Domain d3eo0c1: 3eo0 C:1-108 [209567]
    Other proteins in same PDB: d3eo0a2, d3eo0c2
    automated match to d1rhha1
    complexed with gol

Details for d3eo0c1

PDB Entry: 3eo0 (more details), 1.75 Å

PDB Description: structure of the transforming growth factor-beta neutralizing antibody gc-1008
PDB Compounds: (C:) GC-1008 Fab Light Chain

SCOPe Domain Sequences for d3eo0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eo0c1 b.1.1.1 (C:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleik

SCOPe Domain Coordinates for d3eo0c1:

Click to download the PDB-style file with coordinates for d3eo0c1.
(The format of our PDB-style files is described here.)

Timeline for d3eo0c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eo0c2