Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab H52 (synthetic, humanised version), kappa L chain [48990] (1 PDB entry) |
Domain d2fgwl2: 2fgw L:109-214 [20956] Other proteins in same PDB: d2fgwh1, d2fgwl1 |
PDB Entry: 2fgw (more details), 3 Å
SCOP Domain Sequences for d2fgwl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgwl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain} tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d2fgwl2: