Lineage for d2fbjh2 (2fbj H:119-220)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107325Protein Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha [88580] (1 species)
  7. 1107326Species Mouse (Mus musculus) [TaxId:10090] [88581] (3 PDB entries)
  8. 1107327Domain d2fbjh2: 2fbj H:119-220 [20955]
    Other proteins in same PDB: d2fbjh1, d2fbjl1, d2fbjl2
    part of Fab J539
    complexed with zn

Details for d2fbjh2

PDB Entry: 2fbj (more details), 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution
PDB Compounds: (H:) iga-kappa j539 fab (heavy chain)

SCOPe Domain Sequences for d2fbjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]}
esarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalasg
grytmsnqltlpavecpegesvkcsvqhdsnpvqeldvncsg

SCOPe Domain Coordinates for d2fbjh2:

Click to download the PDB-style file with coordinates for d2fbjh2.
(The format of our PDB-style files is described here.)

Timeline for d2fbjh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fbjh1