![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha [88580] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88581] (3 PDB entries) |
![]() | Domain d2fbjh2: 2fbj H:119-220 [20955] Other proteins in same PDB: d2fbjh1, d2fbjl1, d2fbjl2 part of Fab J539 complexed with zn |
PDB Entry: 2fbj (more details), 1.95 Å
SCOPe Domain Sequences for d2fbjh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} esarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalasg grytmsnqltlpavecpegesvkcsvqhdsnpvqeldvncsg
Timeline for d2fbjh2: