SCOP 1.55: Domain d2fbjh2: 2fbj H:119-220

Lineage for d2fbjh2 (2fbj H:119-220)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab J539 (mouse), kappa L chain [48989] (1 PDB entry)

8. Domain d2fbjh2: 2fbj H:119-220 [20955]
   Other proteins in same PDB: d2fbjh1, d2fbjl1

Details for d2fbjh2

PDB Entry: 2fbj, 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution

SCOP Domain Sequences for d2fbjh2:

Sequence; same for both SEQRES and ATOM records:

>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin (constant domains of L and H chains) {Fab J539 (mouse), kappa L chain}
esarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalasg
grytmsnqltlpavecpegesvkcsvqhdsnpvqeldvncsg

Timeline for d2fbjh2:

• d2fbjh2 appears in SCOP 1.57
  
• d2fbjh2 appears in the current release, SCOPe 2.08