SCOPe 2.08: Domain d3el2a1: 3el2 A:4-146

Lineage for d3el2a1 (3el2 A:4-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)

8. Domain d3el2a1: 3el2 A:4-146 [209548]
   automated match to d1d4xa1
   complexed with atp, ca

Details for d3el2a1

PDB Entry: 3el2, 2.5 Å

PDB Description: crystal structure of monomeric actin bound to ca-atp

PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d3el2a1:

Sequence, based on SEQRES records:

>d3el2a1 c.55.1.1 (A:4-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
evaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d3el2a1 c.55.1.1 (A:4-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
evaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypieh
givtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamy
vaiqavlslyasg

Timeline for d3el2a1:

• d3el2a1 first appeared in SCOPe 2.03
  
• d3el2a1 appears in SCOPe 2.07