Lineage for d3ek1b_ (3ek1 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141168Species Brucella melitensis [TaxId:359391] [225532] (1 PDB entry)
  8. 2141170Domain d3ek1b_: 3ek1 B: [209536]
    Other proteins in same PDB: d3ek1a2
    automated match to d1o9ja_
    complexed with mes, so4

Details for d3ek1b_

PDB Entry: 3ek1 (more details), 2.1 Å

PDB Description: Crystal structure of aldehyde dehydrogenase from brucella melitensis biovar abortus 2308
PDB Compounds: (B:) aldehyde dehydrogenase

SCOPe Domain Sequences for d3ek1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ek1b_ c.82.1.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
mlalkdpsllksqclvngrwidaadgttikvtnpadgsvigtvpslsvatikeaidasak
alsgwaaktakeragilrkwfdliianaddialimtseqgkplaeargevlyaasfiewf
aeeakrvygdtipapqngqrltvirqpvgvtaaitpwnfpaamitrkaapalaagctmiv
rpadltpltalalgvlaekagipagvlqivtgkareigaeltsndtvrklsftgstevgr
llmaqcaptikrislelggnapfivfddadldaavdgamvskyrnagqtcvcanriyvqr
gvydkfaeklaakvkelkvgngtepgvvigpmieekaitkvkahiedavskgaklitggk
elgglffepgiltgvtsdmlvakeetfgplaplfafdteeeviaqandtifglaayfyte
nfsrairvsealeygmvghntglisnevapfggvkqsglgregskygieeyletkyicsa
ykr

SCOPe Domain Coordinates for d3ek1b_:

Click to download the PDB-style file with coordinates for d3ek1b_.
(The format of our PDB-style files is described here.)

Timeline for d3ek1b_: