Lineage for d2ig2h2 (2ig2 H:120-231)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549146Domain d2ig2h2: 2ig2 H:120-231 [20953]
    Other proteins in same PDB: d2ig2h1, d2ig2l1, d2ig2l2
    part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure

Details for d2ig2h2

PDB Entry: 2ig2 (more details), 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)

SCOP Domain Sequences for d2ig2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig2h2 b.1.1.2 (H:120-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcp

SCOP Domain Coordinates for d2ig2h2:

Click to download the PDB-style file with coordinates for d2ig2h2.
(The format of our PDB-style files is described here.)

Timeline for d2ig2h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig2h1