SCOP 1.61: Domain d2ig2h2: 2ig2 H:120-231

Lineage for d2ig2h2 (2ig2 H:120-231)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab KOL (human), lambda L chain [48988] (2 PDB entries)

8. Domain d2ig2h2: 2ig2 H:120-231 [20953]
   Other proteins in same PDB: d2ig2h1, d2ig2l1

Details for d2ig2h2

PDB Entry: 2ig2, 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

SCOP Domain Sequences for d2ig2h2:

Sequence; same for both SEQRES and ATOM records:

>d2ig2h2 b.1.1.2 (H:120-231) Immunoglobulin (constant domains of L and H chains) {Fab KOL (human), lambda L chain}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcp

Timeline for d2ig2h2:

• d2ig2h2 first appeared (with stable ids) in SCOP 1.55
  
• d2ig2h2 appears in SCOP 1.59
  
• d2ig2h2 appears in SCOP 1.63
  
• d2ig2h2 appears in the current release, SCOPe 2.08