Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) in the different families beta-barrels are similarly distorted but may vary in the number of strands |
Family c.6.2.1: alpha-mannosidase [88714] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
Protein Golgi alpha-mannosidase II [88715] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries) Uniprot Q24451 94-1107 |
Domain d3ejta1: 3ejt A:30-411 [209529] Other proteins in same PDB: d3ejta2, d3ejta3 automated match to d1qwna3 complexed with dms, hn6, mrd, nag, zn |
PDB Entry: 3ejt (more details), 1.35 Å
SCOPe Domain Sequences for d3ejta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejta1 c.6.2.1 (A:30-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qcqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphs hndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqm ksivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghs ptmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysy diphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaely rtnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqa eragqaefptlsgdfftyadrs
Timeline for d3ejta1: