SCOPe 2.05: Domain d3ejra3: 3ejr A:523-1045

Lineage for d3ejra3 (3ejr A:523-1045)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
   the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains

6. Protein Golgi alpha-mannosidase II [88657] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d3ejra3: 3ejr A:523-1045 [209525]
   Other proteins in same PDB: d3ejra1, d3ejra2
   automated match to d1qwna2
   complexed with hn4, mrd, nag, zn

Details for d3ejra3

PDB Entry: 3ejr, 1.27 Å

PDB Description: golgi alpha-mannosidase ii in complex with 5-substitued swainsonine analog: (5r)-5-[2'-oxo-2'-(4-tert-butylphenyl)ethyl]-swainsonine

PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3ejra3:

Sequence; same for both SEQRES and ATOM records:

>d3ejra3 b.30.5.6 (A:523-1045) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshss

Timeline for d3ejra3:

• d3ejra3 first appeared in SCOPe 2.03
  
• d3ejra3 appears in SCOPe 2.04
  
• d3ejra3 appears in SCOPe 2.06
  
• d3ejra3 appears in the current release, SCOPe 2.08