SCOPe 2.06: Domain d3ejra2: 3ejr A:412-522

Lineage for d3ejra2 (3ejr A:412-522)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families)

5. Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88694] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d3ejra2: 3ejr A:412-522 [209524]
   Other proteins in same PDB: d3ejra1, d3ejra3
   automated match to d1qwna1
   complexed with hn4, mrd, nag, zn

Details for d3ejra2

PDB Entry: 3ejr, 1.27 Å

PDB Description: golgi alpha-mannosidase ii in complex with 5-substitued swainsonine analog: (5r)-5-[2'-oxo-2'-(4-tert-butylphenyl)ethyl]-swainsonine

PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3ejra2:

Sequence; same for both SEQRES and ATOM records:

>d3ejra2 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

Timeline for d3ejra2:

• d3ejra2 first appeared in SCOPe 2.03
  
• d3ejra2 appears in SCOPe 2.05
  
• d3ejra2 appears in SCOPe 2.07
  
• d3ejra2 appears in the current release, SCOPe 2.08