Lineage for d3ejra1 (3ejr A:30-411)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1352434Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1352508Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 1352509Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 1352510Protein Golgi alpha-mannosidase II [88715] (1 species)
  7. 1352511Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 1352521Domain d3ejra1: 3ejr A:30-411 [209523]
    Other proteins in same PDB: d3ejra2, d3ejra3
    automated match to d1qwna3
    complexed with hn4, mrd, nag, zn

Details for d3ejra1

PDB Entry: 3ejr (more details), 1.27 Å

PDB Description: golgi alpha-mannosidase ii in complex with 5-substitued swainsonine analog: (5r)-5-[2'-oxo-2'-(4-tert-butylphenyl)ethyl]-swainsonine
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3ejra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejra1 c.6.2.1 (A:30-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qcqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphs
hndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqm
ksivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghs
ptmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysy
diphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaely
rtnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqa
eragqaefptlsgdfftyadrs

SCOPe Domain Coordinates for d3ejra1:

Click to download the PDB-style file with coordinates for d3ejra1.
(The format of our PDB-style files is described here.)

Timeline for d3ejra1: