| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) ![]() |
| Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
| Protein Golgi alpha-mannosidase II [88694] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries) Uniprot Q24451 94-1107 |
| Domain d3ejqa2: 3ejq A:412-522 [209521] Other proteins in same PDB: d3ejqa1, d3ejqa3 automated match to d1qwna1 complexed with hn3, mrd, nag, zn |
PDB Entry: 3ejq (more details), 1.45 Å
SCOPe Domain Sequences for d3ejqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejqa2 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs
Timeline for d3ejqa2: