Lineage for d2ig2l2 (2ig2 L:110-214)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293989Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1293993Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1294059Domain d2ig2l2: 2ig2 L:110-214 [20952]
    Other proteins in same PDB: d2ig2h1, d2ig2h2, d2ig2l1
    part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure

Details for d2ig2l2

PDB Entry: 2ig2 (more details), 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)
PDB Compounds: (L:) igg1-lambda kol fab (light chain)

SCOPe Domain Sequences for d2ig2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig2l2 b.1.1.2 (L:110-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d2ig2l2:

Click to download the PDB-style file with coordinates for d2ig2l2.
(The format of our PDB-style files is described here.)

Timeline for d2ig2l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig2l1