SCOPe 2.02: Domain d2ig2l2: 2ig2 L:110-214

Lineage for d2ig2l2 (2ig2 L:110-214)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d2ig2l2: 2ig2 L:110-214 [20952]
   Other proteins in same PDB: d2ig2h1, d2ig2h2, d2ig2l1
   part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure

Details for d2ig2l2

PDB Entry: 2ig2, 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

PDB Compounds: (L:) igg1-lambda kol fab (light chain)

SCOPe Domain Sequences for d2ig2l2:

Sequence; same for both SEQRES and ATOM records:

>d2ig2l2 b.1.1.2 (L:110-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d2ig2l2:

• d2ig2l2 first appeared (with stable ids) in SCOP 1.55
  
• d2ig2l2 appears in SCOPe 2.01
  
• d2ig2l2 appears in SCOPe 2.03
  
• d2ig2l2 appears in the current release, SCOPe 2.08