SCOPe 2.06: Domain d3ejga_: 3ejg A:

Lineage for d3ejga_ (3ejg A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (11 species)
   not a true protein

7. Species Human coronavirus 229E [TaxId:11137] [225531] (3 PDB entries)

8. Domain d3ejga_: 3ejg A: [209516]
   automated match to d2vria_

Details for d3ejga_

PDB Entry: 3ejg, 1.78 Å

PDB Description: crystal structure of hcov-229e x-domain

PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d3ejga_:

Sequence; same for both SEQRES and ATOM records:

>d3ejga_ c.50.1.0 (A:) automated matches {Human coronavirus 229E [TaxId: 11137]}
eklnaflvhdnvafyqgdvdtvvngvdfdfivnaanenlahggglakaldvytkgklqrl
skehiglagkvkvgtgvmvecdslrifnvvgprkgkherdllikayntinneqgtpltpi
lscgifgikletslevlldvcntkevkvfvytdtevckvkdfvsg

Timeline for d3ejga_:

• d3ejga_ first appeared in SCOPe 2.03
  
• d3ejga_ appears in SCOPe 2.05
  
• d3ejga_ appears in SCOPe 2.07
  
• d3ejga_ appears in the current release, SCOPe 2.08