Lineage for d3ej0a_ (3ej0 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384030Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2384138Protein automated matches [191079] (3 species)
    not a true protein
  7. 2384139Species Burkholderia pseudomallei [TaxId:320372] [225482] (6 PDB entries)
  8. 2384142Domain d3ej0a_: 3ej0 A: [209514]
    automated match to d2eipa_
    complexed with 11x

Details for d3ej0a_

PDB Entry: 3ej0 (more details), 1.96 Å

PDB Description: Crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei with bound N-(pyridin-3-ylmethyl) aniline, H32 crystal form
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3ej0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ej0a_ b.40.5.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
fsnvpagkdlpqdfnviieipaqsepvkyeadkalgllvvdrfigtgmrypvnygfipqt
lsgdgdpvdvlvitpfpllagsvvraralgmlkmtdesgvdaklvavphdkvcpmtanlk
siddvpaylkdqikhffeqykalekgkwvkvegwdgidaahkeitdgvanfkk

SCOPe Domain Coordinates for d3ej0a_:

Click to download the PDB-style file with coordinates for d3ej0a_.
(The format of our PDB-style files is described here.)

Timeline for d3ej0a_: