Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [191079] (5 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [225482] (6 PDB entries) |
Domain d3eiza1: 3eiz A:2-175 [209513] Other proteins in same PDB: d3eiza2 automated match to d2eipa_ |
PDB Entry: 3eiz (more details), 1.88 Å
SCOPe Domain Sequences for d3eiza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eiza1 b.40.5.1 (A:2-175) automated matches {Burkholderia pseudomallei [TaxId: 320372]} sfsnvpagkdlpqdfnviieipaqsepvkyeadkalgllvvdrfigtgmrypvnygfipq tlsgdgdpvdvlvitpfpllagsvvraralgmlkmtdesgvdaklvavphdkvcpmtanl ksiddvpaylkdqikhffeqykalekgkwvkvegwdgidaahkeitdgvanfkk
Timeline for d3eiza1: