Lineage for d3eiza1 (3eiz A:2-175)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) 
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
barrel, closed; n=5, S=8
Protein automated matches [191079] (5 species)
not a true protein
Species Burkholderia pseudomallei [TaxId:320372] [225482] (6 PDB entries) 
Domain d3eiza1: 3eiz A:2-175 [209513]
Other proteins in same PDB: d3eiza2
automated match to d2eipa_
Details for d3eiza1
PDB Entry: 3eiz (more details), 1.88 Å
PDB Description: Crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei, H32 crystal form
PDB Compounds: (A:) inorganic pyrophosphataseSCOPe Domain Sequences for d3eiza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eiza1 b.40.5.1 (A:2-175) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
sfsnvpagkdlpqdfnviieipaqsepvkyeadkalgllvvdrfigtgmrypvnygfipq
tlsgdgdpvdvlvitpfpllagsvvraralgmlkmtdesgvdaklvavphdkvcpmtanl
ksiddvpaylkdqikhffeqykalekgkwvkvegwdgidaahkeitdgvanfkk
SCOPe Domain Coordinates for d3eiza1:
Click to download the PDB-style file with coordinates for d3eiza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3eiza1:
- d3eiza1 first appeared in SCOPe 2.03, called d3eiza_
- d3eiza1 appears in SCOPe 2.07
View in 3D
