Lineage for d3eiya_ (3eiy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790843Protein automated matches [191079] (5 species)
    not a true protein
  7. 2790844Species Burkholderia pseudomallei [TaxId:320372] [225482] (6 PDB entries)
  8. 2790848Domain d3eiya_: 3eiy A: [209512]
    automated match to d2eipa_
    complexed with k, na, peg, pg4, pop

Details for d3eiya_

PDB Entry: 3eiy (more details), 2.1 Å

PDB Description: Crystal structure of inorganic pyrophosphatase from burkholderia pseudomallei with bound pyrophosphate
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3eiya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eiya_ b.40.5.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
sfsnvpagkdlpqdfnviieipaqsepvkyeadkalgllvvdrfigtgmrypvnygfipq
tlsgdgdpvdvlvitpfpllagsvvraralgmlkmtdesgvdaklvavphdkvcpmtanl
ksiddvpaylkdqikhffeqykalekgkwvkvegwdgidaahkeitdgvanfkk

SCOPe Domain Coordinates for d3eiya_:

Click to download the PDB-style file with coordinates for d3eiya_.
(The format of our PDB-style files is described here.)

Timeline for d3eiya_: