SCOPe 2.03: Domain d3eixa_: 3eix A:

Lineage for d3eixa_ (3eix A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (18 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [225672] (3 PDB entries)

8. Domain d3eixa_: 3eix A: [209511]
   automated match to d3tefa_
   complexed with cl

Details for d3eixa_

PDB Entry: 3eix, 1.35 Å

PDB Description: crystal structure of selenomethionine labelled staphylococcus aureus lipoprotein, htsa

PDB Compounds: (A:) HtsA protein

SCOPe Domain Sequences for d3eixa_:

Sequence; same for both SEQRES and ATOM records:

>d3eixa_ c.92.2.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
astisvkdengtvkvpkdakrivvleysfadalaaldvkpvgiaddgkkkriikpvreki
gdytsvgtrkqpnleeisklkpdliiadssrhkginkelnkiaptlslksfdgdykqnin
sfktiakalnkekegekrlaehdklinkykdeikfdrnqkvlpavvakagllahpnysyv
gqflnelgfknalsddvtkglskylkgpylqldtehladlnpermiimtdhakkdsaefk
klqedatwkklnavknnrvdivdrdvwarsrglisseemakelvelskke

Timeline for d3eixa_:

• d3eixa_ is new in SCOPe 2.03-stable
  
• d3eixa_ appears in SCOPe 2.04
  
• d3eixa_ appears in the current release, SCOPe 2.08, called d3eixa1