Lineage for d2fb4h2 (2fb4 H:120-221)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453271Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 453285Domain d2fb4h2: 2fb4 H:120-221 [20951]
    Other proteins in same PDB: d2fb4h1, d2fb4l1, d2fb4l2
    part of Fab KOL

Details for d2fb4h2

PDB Entry: 2fb4 (more details), 1.9 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)
PDB Compounds: (H:)

SCOP Domain Sequences for d2fb4h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb4h2 b.1.1.2 (H:120-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc

SCOP Domain Coordinates for d2fb4h2:

Click to download the PDB-style file with coordinates for d2fb4h2.
(The format of our PDB-style files is described here.)

Timeline for d2fb4h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fb4h1