SCOPe 2.07: Domain d3eina2: 3ein A:86-208

Lineage for d3eina2 (3ein A:86-208)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (16 PDB entries)

8. Domain d3eina2: 3ein A:86-208 [209505]
   Other proteins in same PDB: d3eina1
   automated match to d1jlva1
   complexed with gsh

Details for d3eina2

PDB Entry: 3ein, 1.13 Å

PDB Description: delta class gst

PDB Compounds: (A:) Glutathione S-transferase 1-1

SCOPe Domain Sequences for d3eina2:

Sequence; same for both SEQRES and ATOM records:

>d3eina2 a.45.1.0 (A:86-208) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpeafkkieaafeflntflegq
dyaagdsltvadialvatvstfevakfeiskyanvnrwyenakkvtpgweenwagclefk
kyf

Timeline for d3eina2:

• d3eina2 first appeared in SCOPe 2.03
  
• d3eina2 appears in SCOPe 2.06
  
• d3eina2 appears in the current release, SCOPe 2.08