Lineage for d2fb4l2 (2fb4 L:110-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290004Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 290008Species Human (Homo sapiens) [TaxId:9606] [88572] (33 PDB entries)
  8. 290012Domain d2fb4l2: 2fb4 L:110-214 [20950]
    Other proteins in same PDB: d2fb4h1, d2fb4h2, d2fb4l1
    part of Fab KOL

Details for d2fb4l2

PDB Entry: 2fb4 (more details), 1.9 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)

SCOP Domain Sequences for d2fb4l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb4l2 b.1.1.2 (L:110-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOP Domain Coordinates for d2fb4l2:

Click to download the PDB-style file with coordinates for d2fb4l2.
(The format of our PDB-style files is described here.)

Timeline for d2fb4l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fb4l1