![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
![]() | Species Fab KOL (human), lambda L chain [48988] (2 PDB entries) |
![]() | Domain d2fb4l2: 2fb4 L:110-214 [20950] Other proteins in same PDB: d2fb4h1, d2fb4l1 |
PDB Entry: 2fb4 (more details), 1.9 Å
SCOP Domain Sequences for d2fb4l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb4l2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {Fab KOL (human), lambda L chain} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d2fb4l2: