SCOPe 2.08: Domain d3eg3a1: 3eg3 A:60-121

Lineage for d3eg3a1 (3eg3 A:60-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d3eg3a1: 3eg3 A:60-121 [209492]
   Other proteins in same PDB: d3eg3a2
   automated match to d1ju5c_
   complexed with gol; mutant

Details for d3eg3a1

PDB Entry: 3eg3, 1.4 Å

PDB Description: crystal structure of the n114a mutant of abl-sh3 domain

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3eg3a1:

Sequence; same for both SEQRES and ATOM records:

>d3eg3a1 b.34.2.1 (A:60-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
endpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitpv
ns

Timeline for d3eg3a1:

• d3eg3a1 first appeared in SCOPe 2.03, called d3eg3a_
  
• d3eg3a1 appears in SCOPe 2.07