Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein automated matches [190043] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187799] (15 PDB entries) |
Domain d3eg2a_: 3eg2 A: [209491] automated match to d1ju5c_ complexed with gol; mutant |
PDB Entry: 3eg2 (more details), 1.8 Å
SCOPe Domain Sequences for d3eg2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eg2a_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsqyitp vns
Timeline for d3eg2a_: