Lineage for d3ef5a_ (3ef5 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211807Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2211808Protein automated matches [191036] (16 species)
    not a true protein
  7. 2211833Species Bdellovibrio bacteriovorus [TaxId:959] [225632] (4 PDB entries)
  8. 2211838Domain d3ef5a_: 3ef5 A: [209482]
    automated match to d3gwyb_
    protein/RNA complex; complexed with dgt

Details for d3ef5a_

PDB Entry: 3ef5 (more details), 2.6 Å

PDB Description: structure of the rna pyrophosphohydrolase bdrpph in complex with dgtp
PDB Compounds: (A:) Probable pyrophosphohydrolase

SCOPe Domain Sequences for d3ef5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ef5a_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]}
hwipvvagflrkdgkilvgqrpennslagqwefpggkiengetpeealarelneelgiea
evgelklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanrki
lhkiykalglew

SCOPe Domain Coordinates for d3ef5a_:

Click to download the PDB-style file with coordinates for d3ef5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ef5a_: