Lineage for d3ef2d2 (3ef2 D:156-293)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534672Family d.3.1.18: MOA C-terminal domain-like [159846] (2 proteins)
    PfamB PB070855
  6. 2534673Protein Agglutinin MOA [159847] (1 species)
  7. 2534674Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159848] (2 PDB entries)
    Uniprot Q8X123 156-293
  8. 2534678Domain d3ef2d2: 3ef2 D:156-293 [209481]
    Other proteins in same PDB: d3ef2a1, d3ef2b1, d3ef2c1, d3ef2d1
    automated match to d2ihoa2
    complexed with act, ca

Details for d3ef2d2

PDB Entry: 3ef2 (more details), 1.8 Å

PDB Description: structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.
PDB Compounds: (D:) agglutinin

SCOPe Domain Sequences for d3ef2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ef2d2 d.3.1.18 (D:156-293) Agglutinin MOA {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc
ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep
qnggylndigydsymafy

SCOPe Domain Coordinates for d3ef2d2:

Click to download the PDB-style file with coordinates for d3ef2d2.
(The format of our PDB-style files is described here.)

Timeline for d3ef2d2: