| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.18: MOA C-terminal domain-like [159846] (2 proteins) PfamB PB070855 |
| Protein Agglutinin MOA [159847] (1 species) |
| Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159848] (2 PDB entries) Uniprot Q8X123 156-293 |
| Domain d3ef2b2: 3ef2 B:156-293 [209477] Other proteins in same PDB: d3ef2a1, d3ef2b1, d3ef2c1, d3ef2d1 automated match to d2ihoa2 complexed with act, ca |
PDB Entry: 3ef2 (more details), 1.8 Å
SCOPe Domain Sequences for d3ef2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ef2b2 d.3.1.18 (B:156-293) Agglutinin MOA {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc
ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep
qnggylndigydsymafy
Timeline for d3ef2b2: