SCOPe 2.08: Domain d3ef2a2: 3ef2 A:156-293

Lineage for d3ef2a2 (3ef2 A:156-293)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.18: MOA C-terminal domain-like [159846] (2 proteins)
   PfamB PB070855

6. Protein Agglutinin MOA [159847] (1 species)

7. Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159848] (2 PDB entries)
   Uniprot Q8X123 156-293

8. Domain d3ef2a2: 3ef2 A:156-293 [209475]
   Other proteins in same PDB: d3ef2a1, d3ef2b1, d3ef2c1, d3ef2d1
   automated match to d2ihoa2
   complexed with act, ca

Details for d3ef2a2

PDB Entry: 3ef2, 1.8 Å

PDB Description: structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.

PDB Compounds: (A:) agglutinin

SCOPe Domain Sequences for d3ef2a2:

Sequence; same for both SEQRES and ATOM records:

>d3ef2a2 d.3.1.18 (A:156-293) Agglutinin MOA {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
msvssaeaqaaiarnphihgtyrgyildgeylvlpnatftqiwkdsglpgskwreqiydc
ddfaiamkaavgkwgadswkangfaifcgvmlgvnkagdaahaynftltkdhadivffep
qnggylndigydsymafy

Timeline for d3ef2a2:

• d3ef2a2 first appeared in SCOPe 2.03
  
• d3ef2a2 appears in SCOPe 2.07