| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (59 species) not a true protein |
| Species Silicibacter pomeroyi [TaxId:89184] [225529] (1 PDB entry) |
| Domain d3eeza2: 3eez A:128-369 [209473] Other proteins in same PDB: d3eeza1 automated match to d1nu5a1 |
PDB Entry: 3eez (more details), 2.8 Å
SCOPe Domain Sequences for d3eeza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eeza2 c.1.11.0 (A:128-369) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
gsrtprpiassvgaksveetravidryrqrgyvahsvkiggdverdiarirdvedirepg
eivlydvnrgwtrqqalrvmratedlhvmfeqpgetlddiaairplhsapvsvdeclvtl
qdaarvardglaevfgiklnrvggltraarmrdialthgidmfvmatggsvladaealhl
aatipdhachavwacqdmltvdiaggrgprnidghlhlpetpglgvhpdedalgdpvavy
se
Timeline for d3eeza2: