Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Silicibacter pomeroyi [TaxId:89184] [225528] (1 PDB entry) |
Domain d3eeza1: 3eez A:1-127 [209472] Other proteins in same PDB: d3eeza2 automated match to d1nu5a2 |
PDB Entry: 3eez (more details), 2.8 Å
SCOPe Domain Sequences for d3eeza1:
Sequence, based on SEQRES records: (download)
>d3eeza1 d.54.1.0 (A:1-127) automated matches {Silicibacter pomeroyi [TaxId: 89184]} lkitritvyqvdlplehpywlsggrlkfelldatlvkletdagitgwgegtpwghtyvpa hgpgiragietmapfvlgldprrlldveramdialpghlyakspidmacwdiagqaaglp iadlmgg
>d3eeza1 d.54.1.0 (A:1-127) automated matches {Silicibacter pomeroyi [TaxId: 89184]} lkitritvyqvdlplehpywkfelldatlvkletdagitgwgegtpwghtyvpahgpgir agietmapfvlgldprrlldveramdialpghlyakspidmacwdiagqaaglpiadlmg g
Timeline for d3eeza1: