Lineage for d3eeza1 (3eez A:2-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948565Species Silicibacter pomeroyi [TaxId:89184] [225528] (1 PDB entry)
  8. 2948566Domain d3eeza1: 3eez A:2-127 [209472]
    Other proteins in same PDB: d3eeza2, d3eeza3, d3eeza4
    automated match to d1nu5a2

Details for d3eeza1

PDB Entry: 3eez (more details), 2.8 Å

PDB Description: crystal structure of a putative mandelate racemase/muconate lactonizing enzyme from silicibacter pomeroyi
PDB Compounds: (A:) putative mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3eeza1:

Sequence, based on SEQRES records: (download)

>d3eeza1 d.54.1.0 (A:2-127) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
kitritvyqvdlplehpywlsggrlkfelldatlvkletdagitgwgegtpwghtyvpah
gpgiragietmapfvlgldprrlldveramdialpghlyakspidmacwdiagqaaglpi
adlmgg

Sequence, based on observed residues (ATOM records): (download)

>d3eeza1 d.54.1.0 (A:2-127) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
kitritvyqvdlplehpywkfelldatlvkletdagitgwgegtpwghtyvpahgpgira
gietmapfvlgldprrlldveramdialpghlyakspidmacwdiagqaaglpiadlmgg

SCOPe Domain Coordinates for d3eeza1:

Click to download the PDB-style file with coordinates for d3eeza1.
(The format of our PDB-style files is described here.)

Timeline for d3eeza1: