Lineage for d3eeub_ (3eeu B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428504Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1428505Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1428789Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 1428790Protein automated matches [191036] (8 species)
    not a true protein
  7. 1428797Species Bdellovibrio bacteriovorus [TaxId:959] [225632] (4 PDB entries)
  8. 1428801Domain d3eeub_: 3eeu B: [209471]
    automated match to d3gwyb_
    protein/RNA complex; complexed with act, cl, ho

Details for d3eeub_

PDB Entry: 3eeu (more details), 2 Å

PDB Description: structure of the rna pyrophosphohydrolase bdrpph in complex with holmium
PDB Compounds: (B:) Probable pyrophosphohydrolase

SCOPe Domain Sequences for d3eeub_:

Sequence, based on SEQRES records: (download)

>d3eeub_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]}
kghwipvvagflrkdgkilvgqrpennslagqwefpggkiengetpeealarelneelgi
eaevgelklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanr
kilhkiykalglew

Sequence, based on observed residues (ATOM records): (download)

>d3eeub_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]}
kghwipvvagflrkdgkilvgqrpegqwefpggkiengetpeealarelneelgieaevg
elklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanrkilhk
iykalglew

SCOPe Domain Coordinates for d3eeub_:

Click to download the PDB-style file with coordinates for d3eeub_.
(The format of our PDB-style files is described here.)

Timeline for d3eeub_: