SCOP 1.59: Domain d2f19h2: 2f19 H:124-221

Lineage for d2f19h2 (2f19 H:124-221)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab R19.9 (mouse), kappa L chain [48987] (2 PDB entries)

8. Domain d2f19h2: 2f19 H:124-221 [20947]
   Other proteins in same PDB: d2f19h1, d2f19l1

Details for d2f19h2

PDB Entry: 2f19, 2.8 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d2f19h2:

Sequence; same for both SEQRES and ATOM records:

>d2f19h2 b.1.1.2 (H:124-221) Immunoglobulin (constant domains of L and H chains) {Fab R19.9 (mouse), kappa L chain}
sakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs
alytmsssvtvpsstwpsqtvtcsvahpassttvdkkl

Timeline for d2f19h2:

• d2f19h2 first appeared (with stable ids) in SCOP 1.55
  
• d2f19h2 appears in SCOP 1.57
  
• d2f19h2 appears in SCOP 1.61
  
• d2f19h2 appears in the current release, SCOPe 2.08