Lineage for d3eefb_ (3eef B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445599Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445600Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2445653Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2445654Protein automated matches [190499] (24 species)
    not a true protein
  7. 2445774Species Thermoplasma acidophilum [TaxId:2303] [225522] (1 PDB entry)
  8. 2445776Domain d3eefb_: 3eef B: [209467]
    automated match to d1j2ra_
    complexed with zn

Details for d3eefb_

PDB Entry: 3eef (more details), 2.35 Å

PDB Description: Crystal structure of N-carbamoylsarcosine amidase from thermoplasma acidophilum
PDB Compounds: (B:) N-carbamoylsarcosine amidase related protein

SCOPe Domain Sequences for d3eefb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eefb_ c.33.1.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mkpalvvvdmvnefihgrlatpeamktvgparkvietfrrsglpvvyvndshypddpeir
iwgrhsmkgddgsevideirpsagdyvlekhaysgfygtnldmilrangidtvvliglda
dicvrhtaadalyrnyriivvedavaaridpnwkdyftrvygatvkrsdeieg

SCOPe Domain Coordinates for d3eefb_:

Click to download the PDB-style file with coordinates for d3eefb_.
(The format of our PDB-style files is described here.)

Timeline for d3eefb_: