SCOP 1.73: Domain d2f19l2: 2f19 L:109-214

Lineage for d2f19l2 (2f19 L:109-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d2f19l2: 2f19 L:109-214 [20946]
   Other proteins in same PDB: d2f19h1, d2f19h2, d2f19l1
   part of Fab R19.9

Details for d2f19l2

PDB Entry: 2f19, 2.8 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

PDB Compounds: (L:) igg2b-kappa r19.9 fab (light chain)

SCOP Domain Sequences for d2f19l2:

Sequence; same for both SEQRES and ATOM records:

>d2f19l2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2f19l2:

• d2f19l2 first appeared (with stable ids) in SCOP 1.55
  
• d2f19l2 appears in SCOP 1.71
  
• d2f19l2 appears in SCOP 1.75
  
• d2f19l2 appears in the current release, SCOPe 2.08