SCOPe 2.06: Domain d3ecyb_: 3ecy B:

Lineage for d3ecyb_ (3ecy B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225535] (1 PDB entry)

8. Domain d3ecyb_: 3ecy B: [209459]
   automated match to d1sixa_

Details for d3ecyb_

PDB Entry: 3ecy, 1.88 Å

PDB Description: Crystal structural analysis of Drosophila melanogaster dUTPase

PDB Compounds: (B:) CG4584-PA, isoform A (BcDNA.LD08534)

SCOPe Domain Sequences for d3ecyb_:

Sequence, based on SEQRES records:

>d3ecyb_ b.85.4.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tcvlrfakltenalepvrgsakaagvdlrsaydvvvpargkaivktdlqvqvpegsygrv
aprsglavknfidvgagvvdedyrgnlgvvlfnhsdvdfevkhgdriaqficerifypql
vmvdkl

Sequence, based on observed residues (ATOM records):

>d3ecyb_ b.85.4.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tcvlrfakltenalepvrgsakaagvdlrsaydvvvpargkaivktdlqvqvpegsygrv
aprfidvgagvvdedyrgnlgvvlfnhsdvdfevkhgdriaqficerifypqlvmvdkl

Timeline for d3ecyb_:

• d3ecyb_ first appeared in SCOPe 2.03
  
• d3ecyb_ appears in SCOPe 2.05
  
• d3ecyb_ appears in SCOPe 2.07
  
• d3ecyb_ appears in the current release, SCOPe 2.08