Lineage for d3ecyb_ (3ecy B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2072562Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2072756Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2072757Protein automated matches [191182] (15 species)
    not a true protein
  7. 2072886Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225535] (1 PDB entry)
  8. 2072888Domain d3ecyb_: 3ecy B: [209459]
    automated match to d1sixa_

Details for d3ecyb_

PDB Entry: 3ecy (more details), 1.88 Å

PDB Description: Crystal structural analysis of Drosophila melanogaster dUTPase
PDB Compounds: (B:) CG4584-PA, isoform A (BcDNA.LD08534)

SCOPe Domain Sequences for d3ecyb_:

Sequence, based on SEQRES records: (download)

>d3ecyb_ b.85.4.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tcvlrfakltenalepvrgsakaagvdlrsaydvvvpargkaivktdlqvqvpegsygrv
aprsglavknfidvgagvvdedyrgnlgvvlfnhsdvdfevkhgdriaqficerifypql
vmvdkl

Sequence, based on observed residues (ATOM records): (download)

>d3ecyb_ b.85.4.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tcvlrfakltenalepvrgsakaagvdlrsaydvvvpargkaivktdlqvqvpegsygrv
aprfidvgagvvdedyrgnlgvvlfnhsdvdfevkhgdriaqficerifypqlvmvdkl

SCOPe Domain Coordinates for d3ecyb_:

Click to download the PDB-style file with coordinates for d3ecyb_.
(The format of our PDB-style files is described here.)

Timeline for d3ecyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ecya_