Lineage for d3ecdb_ (3ecd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132345Species Burkholderia pseudomallei [TaxId:28450] [225995] (3 PDB entries)
  8. 2132347Domain d3ecdb_: 3ecd B: [209455]
    automated match to d3n0la_
    complexed with gol

Details for d3ecdb_

PDB Entry: 3ecd (more details), 1.6 Å

PDB Description: Crystal structure of serine hydroxymethyltransferase from Burkholderia pseudomallei
PDB Compounds: (B:) Serine hydroxymethyltransferase 2

SCOPe Domain Sequences for d3ecdb_:

Sequence, based on SEQRES records: (download)

>d3ecdb_ c.67.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
nanpffsqslaerdasvrgailkelerqqsqveliasenivsravldaqgsvltnkyaeg
ypgkryyggcefadevealaiervkrlfnaghanvqphsgaqangavmlalakpgdtvlg
msldagghlthgakpalsgkwfnalqygvsrdtmlidydqvealaqqhkpsliiagfsay
prkldfarfraiadsvgaklmvdmahiagviaagrhanpvehahvvtstthktlrgprgg
fvltndeeiakkinsavfpglqggplmhviagkavafgealtddfktyidrvlanaqalg
dvlkaggvdlvtggtdnhlllvdlrpkglkgaqveqaleragitcnkngipfdpekptit
sgirlgtpagttrgfgaaefrevgrlilevfealrtnpegdhateqrvrreifalcerfp
iy

Sequence, based on observed residues (ATOM records): (download)

>d3ecdb_ c.67.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
nanpffsqslaerdasvrgailkelerqqsqveliasenivsravldaqgsvltnkyaeg
yadevealaiervkrlfnaghanvqphsgaqangavmlalakpgdtvlgmslfnalqygv
srdtmlidydqvealaqqhkpsliiagfsayprkldfarfraiadsvgaklmvdmahiag
viaagrhanpvehahvvtstthktlrgprggfvltndeeiakkinsavfpgplmhviagk
avafgealtddfktyidrvlanaqalgdvlkaggvdlvtggtdnhlllvdlrpkglkgaq
veqaleragitcnkngipfdpekptitsgirlgtpagttrgfgaaefrevgrlilevfea
lrtnpegdhateqrvrreifalcerfpiy

SCOPe Domain Coordinates for d3ecdb_:

Click to download the PDB-style file with coordinates for d3ecdb_.
(The format of our PDB-style files is described here.)

Timeline for d3ecdb_: