Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
Domain d3ebsd_: 3ebs D: [209453] Other proteins in same PDB: d3ebsb2 automated match to d1dt6a_ complexed with hem, n4e |
PDB Entry: 3ebs (more details), 2.15 Å
SCOPe Domain Sequences for d3ebsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ebsd_ a.104.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgsfq ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee idrvigknrqpkfedrakmpymeaviheiqrfgdvipmglarrvkkdtkfrdfflpkgte vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
Timeline for d3ebsd_:
View in 3D Domains from other chains: (mouse over for more information) d3ebsa_, d3ebsb1, d3ebsb2, d3ebsc_ |