![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196470] (52 PDB entries) |
![]() | Domain d3ebsc_: 3ebs C: [209452] Other proteins in same PDB: d3ebsb2 automated match to d1dt6a_ complexed with hem, n4e |
PDB Entry: 3ebs (more details), 2.15 Å
SCOPe Domain Sequences for d3ebsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ebsc_ a.104.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavrea lvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeriq eeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgsfq ftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfids flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee idrvigknrqpkfedrakmpymeaviheiqrfgdvipmglarrvkkdtkfrdfflpkgte vypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmelf lffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr
Timeline for d3ebsc_:
![]() Domains from other chains: (mouse over for more information) d3ebsa_, d3ebsb1, d3ebsb2, d3ebsd_ |