Lineage for d3ebsa_ (3ebs A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005621Domain d3ebsa_: 3ebs A: [209450]
    Other proteins in same PDB: d3ebsb2
    automated match to d1dt6a_
    complexed with hem, n4e

Details for d3ebsa_

PDB Entry: 3ebs (more details), 2.15 Å

PDB Description: human cytochrome p450 2a6 i208s/i300f/g301a/s369g in complex with phenacetin
PDB Compounds: (A:) Cytochrome P450 2A6

SCOPe Domain Sequences for d3ebsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ebsa_ a.104.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavre
alvdqaeefsgrgeqatfdwvfkgygvvfsngerakqlrrfsiatlrdfgvgkrgieeri
qeeagflidalrgtgganidptfflsrtvsnvissivfgdrfdykdkeflsllrmmlgsf
qftststgqlyemfssvmkhlpgpqqqafqllqgledfiakkvehnqrtldpnsprdfid
sflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhe
eidrvigknrqpkfedrakmpymeaviheiqrfgdvipmglarrvkkdtkfrdfflpkgt
evypmlgsvlrdpsffsnpqdfnpqhflnekgqfkksdafvpfsigkrncfgeglarmel
flffttvmqnfrlkssqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d3ebsa_:

Click to download the PDB-style file with coordinates for d3ebsa_.
(The format of our PDB-style files is described here.)

Timeline for d3ebsa_: