SCOP 1.67: Domain d1ineh2: 1ine H:115-213

Lineage for d1ineh2 (1ine H:115-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1ineh2: 1ine H:115-213 [20945]
   Other proteins in same PDB: d1ineh1, d1inel1, d1inel2
   part of Fab Cha255
   complexed with eot, fe

Details for d1ineh2

PDB Entry: 1ine, 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1ineh2:

Sequence; same for both SEQRES and ATOM records:

>d1ineh2 b.1.1.2 (H:115-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdl
ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1ineh2:

• d1ineh2 first appeared (with stable ids) in SCOP 1.55
  
• d1ineh2 appears in SCOP 1.65
  
• d1ineh2 appears in SCOP 1.69
  
• d1ineh2 appears in the current release, SCOPe 2.08