![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
![]() | Protein automated matches [190561] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries) |
![]() | Domain d3eaza_: 3eaz A: [209448] automated match to d3s9ka_ mutant |
PDB Entry: 3eaz (more details), 1.31 Å
SCOPe Domain Sequences for d3eaza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eaza_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvssdgkvehyrim yhasklsideevyfenlmqlvehytsdadglctrlikpkvme
Timeline for d3eaza_: